PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0115s0048.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family G2-like
Protein Properties Length: 493aa    MW: 51924.2 Da    PI: 7.3198
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0115s0048.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.76.2e-3452106155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+rlrWtpeLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Mapoly0115s0048.2.p  52 KQRLRWTPELHERFVDAVTQLGGADRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 106
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7549109IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-3350107IPR009057Homeodomain-like
SuperFamilySSF466899.32E-1851106IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-2552107IPR006447Myb domain, plants
PfamPF002493.7E-954105IPR001005SANT/Myb domain
PfamPF143795.0E-25139185IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MYAAKKFSTS SLVPQRPGQV PDPRGSNAAG GSTNSGGSPV ASGGGGGGSA AKQRLRWTPE  60
LHERFVDAVT QLGGADRATP KGVLRVMGVQ GLTIYHVKSH LQKYRLAKYI PESMSDGGKS  120
EKKKNPADII PSLDATSGIQ ITEALRMQME VQKRLHEQLE VQRHLQLRIE AQGKYLQKII  180
EEQQRHGGLL NGRAVPSEPG SATYPVPLAE MAPGQTPAGG VKYDSTSVSL PEGPGTSKPS  240
TESLAPGSSV QATTEAPALE TSGPVDQASG LTSQPQETAQ FLGYSSADKS GGQIAQPPQK  300
RIRLDESSVQ SQPQSEAANN LSGQAASFPS ADSMSVEGVS TPFHSNSQNY NPSAQEFAPL  360
SAFQSSTGGS FPQQSSTQQS ENVQGRAQYQ TGFQQQSMQP IDSSVGLVAP PQHSPRPQPP  420
SQPQLSSTPI RSQSPMRQEA RVFSSSGVDN LEESDNGGVP RKPQFGANSL DVGGGQGRNL  480
PSSQTGVYEQ WD*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-74G2-like family protein